PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA19G00350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 250aa    MW: 28480.7 Da    PI: 5.9615
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA19G00350genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.25.3e-101259347
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqky 47
                      WT+eE +++ +a + +  +    tW  Ia+ ++ g+t  +++ ++  +
       AA19G00350 12 TWTPEENKRFEKALAFHDDKdnpnTWLQIAQAIP-GKTVDDVIQHYKEL 59
                     5*****************99**************.***********977 PP

2Myb_DNA-binding49.87.9e-16120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + k++G+g+W+ Ia+   k+Rt+ q+ s+ qky
       AA19G00350 120 PWTEEEHRLFLMGLKKYGKGDWRNIAKNYVKTRTPTQVASHAQKY 164
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.496862IPR017884SANT domain
SMARTSM007171.6E-7962IPR001005SANT/Myb domain
PfamPF002491.0E-71260IPR001005SANT/Myb domain
SuperFamilySSF466892.37E-101267IPR009057Homeodomain-like
CDDcd001673.50E-81260No hitNo description
Gene3DG3DSA:1.10.10.601.3E-51261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-14111170IPR009057Homeodomain-like
PROSITE profilePS5129422.431113169IPR017930Myb domain
SuperFamilySSF466891.27E-17115168IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17116168IPR006447Myb domain, plants
SMARTSM007171.1E-13117167IPR001005SANT/Myb domain
PfamPF002492.7E-13120164IPR001005SANT/Myb domain
CDDcd001671.16E-12120165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MASMNWLFQE ATWTPEENKR FEKALAFHDD KDNPNTWLQI AQAIPGKTVD DVIQHYKELL  60
DDVSDIEAGL IPIPGYNTDY FFNLENSNYD YIVGDKRSSP AISNSFRSPM PEKERKKGVP  120
WTEEEHRLFL MGLKKYGKGD WRNIAKNYVK TRTPTQVASH AQKYFIRQLT DGKDKRRSSI  180
HDITTVNIPD VDLTVTGATS TNTNIDATST IFSNTNIPNS SFDVFFRSNL GYGLASASSC  240
DYIHTFSQEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1513781175RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006398645.11e-112hypothetical protein EUTSA_v10014410mg
SwissprotQ8S9H72e-76DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV4LJX81e-111V4LJX8_EUTSA; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_60000791e-110(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148841619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01200.11e-110MYB family protein